SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012436402.1.43321 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012436402.1.43321
Domain Number 1 Region: 95-357
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 1.7e-75
Family D-glucarate dehydratase-like 0.00014
Further Details:      
 
Domain Number 2 Region: 1-112
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.46e-33
Family Enolase N-terminal domain-like 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012436402.1.43321
Sequence length 382
Comment D-galactonate dehydratase [Ralstonia pickettii]; AA=GCF_000020205.1; RF=representative genome; TAX=402626; STAX=329; NAME=Ralstonia pickettii 12J; strain=12J; AL=Complete Genome; RT=Major
Sequence
MKITRLTTYRLPPRWMFLKVETDEGVTGWGEPVIEGRARTVEAAVHELSDYLIGQDPSRI
NDLWQTMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLGVPVYELLGGLVRDKMRTYSWV
GGDRPADVIAGMKALQAGGFDHFKLNGCEEMGIIDTSRAVDAAVARVAEIRSAFGNTVEF
GLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAETYARLAAHTHLPIAAGERMFSR
FDFKRVLEAGGVSILQPDLSHAGGITECVKIAAMAEAYDVALAPHCPLGPIALAACLHVD
FVSWNATLQEQSMGIHYNKGAELLDYVRNKADFALEGGYIRPPRLPGLGVDIDEALVIER
SKEAPDWRNPVWRHADGSVAEW
Download sequence
Identical sequences B2UCA8
402626.Rpic_2990 gi|187930058|ref|YP_001900545.1| WP_012436402.1.43321 WP_012436402.1.7297

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]