SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012442725.1.58220 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012442725.1.58220
Domain Number 1 Region: 55-504
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.99e-119
Family Pyridoxal-dependent decarboxylase 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012442725.1.58220
Sequence length 517
Comment cytochrome c biogenesis protein CcmH [Erwinia tasmaniensis]; AA=GCF_000026185.1; RF=na; TAX=465817; STAX=338565; NAME=Erwinia tasmaniensis Et1/99; strain=Et1/99; AL=Complete Genome; RT=Major
Sequence
MVLGSHTSQVTERHPGYRAGDPHDFIFNDHQLPAWVQQSEQVLALITETVKGVEKPFSGI
LPHELAREFSGVNLDQPLGSNEAALEELKKLYLRDAVWFHHPKYVAHLNCPVVLPSLLAE
QIMATVNSSVDTWDQSAGGTLIEQKVIDWTLGRIGLPAGADGIFTSGGTQSNLMAMLLAR
DSWCAAHHQGHMIKHQGLPQDAAKWRVFTSKLSHFSIQKSMAILGLGYDAVIPVDFDEHY
RMDAACLEQEIQRCHQQGLIPIAVVATSGTTDFGSIDPLGAISDLCNQHGMWMHVDAAYG
CGLLVSENHRQRLAGIEKADSVTVDYHKSFFQTVSCGAFFVRDKHNLSHVTHHADYLNPL
SAQQEGTPNLVNKSIQTTRRFDALKMWLTLRISGPTALGNAFDDILALTQTTHQLLNAHP
TIEVLHAPELTTQIFRYVPRPGLNDEQIDDINANIRKAVFRSGNAVIAGTKVNGRQYLKF
TLLNPNTTVADIEDVIALIVHYGREQACGPTVTTAHL
Download sequence
Identical sequences B2VCR4
WP_012442725.1.58220 gi|188535146|ref|YP_001908943.1| 465817.ETA_30280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]