SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012449779.1.1917 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012449779.1.1917
Domain Number 1 Region: 92-160,216-283
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.07e-36
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0028
Further Details:      
 
Domain Number 2 Region: 160-216
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.07e-16
Family Short-chain ferredoxins 0.018
Further Details:      
 
Domain Number 3 Region: 10-96
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 0.000000000000818
Family Duplicated SiR/NiR-like domains 1 and 3 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012449779.1.1917
Sequence length 285
Comment sulfite reductase subunit C [Clostridium botulinum]; AA=GCF_001573615.1; RF=na; TAX=1491; STAX=1491; NAME=Clostridium botulinum; strain=CDC 5247; AL=Contig; RT=Major
Sequence
MAVNAKRQKELKALGFLLQNDKEHFAVRFLGRAGNFTVEELNNINIIAKKYGRDYCGMTT
RLQIEVAWIKDEDVEKVIEEAKKLGLRHGGTGQKFRPLVSCKGTVCLHGNINTQEICRQL
EDKYFGTDTPHKCKVAVVGCANNCAKANINDIGIMGRTVPEFVLDKCVGCGLCVKACRQK
ALEVVDKKIVHNKDLCVDCGGCVRACKLGAAVAKEKGGEIFVGGRFGRGMRIGDSLGKIF
KEEEIIPMVDKIVDYYREVGQPGERVSKVMDRIGKEEFINNVLNR
Download sequence
Identical sequences A0A1X2J488
508767.CLH_2652 gi|188587996|ref|YP_001922032.1| WP_012449779.1.16164 WP_012449779.1.17341 WP_012449779.1.1917 WP_012449779.1.31784 WP_012449779.1.43682 WP_012449779.1.53901 WP_012449779.1.58365 WP_012449779.1.64077 WP_012449779.1.64452 WP_012449779.1.65636 WP_012449779.1.87966 WP_012449779.1.92433 WP_012449779.1.9385 WP_012449779.1.97908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]