SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012458669.1.22673 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012458669.1.22673
Domain Number 1 Region: 12-227
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.79e-55
Family PP-loop ATPase 0.00017
Further Details:      
 
Domain Number 2 Region: 370-439
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000000000034
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012458669.1.22673
Sequence length 454
Comment tRNA(Ile)-lysidine synthetase [Porphyromonas gingivalis]; AA=GCF_900157215.1; RF=na; TAX=837; STAX=837; NAME=Porphyromonas gingivalis; strain=3_3; AL=Scaffold; RT=Major
Sequence
MKISLTNRVRTTIRERKLFREGNRLVLVALSGGADSVALLCVLRELGYETVAAHCNFHLR
GVESDEDAAFVEGLCRDLDVPLHRIDFDTVRYARERSISIEMAARELRYEWFGLLRKELA
IEYVAVAHHADDNAETMVLNLCRGTGISGLCGMPYKRNDGIVRPLLDATRDEIEAYLLDQ
KITYRTDSSNEDTRFRRNLVRHRIMPLLKELNPSLQEALLRTRENLEGVAAFFSKATEDF
HNTLRATASISIREVKETPAPFTLLYDLLHPYGFNRDQIREVVTSLDNPPGASFFSSSHR
LLRERDRLTVLPLSPKMEVPELFGLKIGDSFLDLPDGKQLSWQRGTPADLDLEGLRLPNT
KLLLPLAFVESLQEELGVRRPQRGDHIHPYGMKGCKTVSRFFIDRHVPRRRREEAWLLCQ
GTEVVWIMGYAADRRFAIDELSDTEEYLLFSFEL
Download sequence
Identical sequences A0A2I7MYU7 B2RMB4
431947.PGN_1991 WP_012458669.1.22673 WP_012458669.1.48852 WP_012458669.1.79666 WP_012458669.1.99922 gi|188995854|ref|YP_001930106.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]