SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012504505.1.43358 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012504505.1.43358
Domain Number 1 Region: 5-60
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 2.22e-16
Family Ribosomal protein L30p/L7e 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012504505.1.43358
Sequence length 61
Comment 50S ribosomal protein L30 [Candidatus Phytoplasma mali]; AA=GCF_000026205.1; RF=na; TAX=37692; STAX=37692; NAME=Candidatus Phytoplasma mali; strain=AT; AL=Complete Genome; RT=Major
Sequence
MKKPQFIIILNKSLIARTKSQIQTAHILGLRKINQKVIKDDNPVNRGMIRKIYHLVTIEK
L
Download sequence
Identical sequences B3R009
gi|194246751|ref|YP_002004390.1| 37692.ATP_00359 WP_012504505.1.43358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]