SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012504632.1.66998 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012504632.1.66998
Domain Number 1 Region: 29-179
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.38e-61
Family DsrA/DsrB N-terminal-domain-like 0.0000158
Further Details:      
 
Domain Number 2 Region: 182-253,322-416
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.93e-48
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000127
Further Details:      
 
Domain Number 3 Region: 240-317
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 4.59e-16
Family Ferredoxin domains from multidomain proteins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012504632.1.66998
Sequence length 417
Comment sulfite reductase, dissimilatory-type subunit alpha [Prosthecochloris aestuarii]; AA=GCF_000020625.1; RF=representative genome; TAX=290512; STAX=1102; NAME=Prosthecochloris aestuarii DSM 271; strain=DSM 271; AL=Complete Genome; RT=Major
Sequence
MDGANDGASKGACNCGGCGSDGNDKFLNPTPMLDELESGPWPSFVSGFKEMAERTKKPML
RGVLDQLEYSYNTKMGYWKGGLVTVDGYGAGIITRYSMIKDKIPEAAEFHTMRIQPAPGL
HYNTDMLRELCDIWEKYGSGIITLHGQTGDIMLQGIEQDKVQECFDELNEKGWDLGGAGA
GMRTGVSCIGPGRCENACYDNLKLHLKALKHFVGQVHRPEWNYKLKFKFSGCPNDCTNAI
MRSDLAVIGTWKDAIQVDRDEVRSWIEERGVDALVNQVINHCPTKAISLNDGDMVIEARD
CVRCMHCLNVMPKALSPGRERGISLLMGGKNTLKVGVNMGSLIVPFMKMESDEDIEEFLE
LIEEIIDWWDDAGLDHERIGETIERVGLKQFLEGIGREADINMVSRPRDNPYFKAKY
Download sequence
Identical sequences B4S963
gi|194332882|ref|YP_002014742.1| 290512.Paes_0029 WP_012504632.1.66998

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]