SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012519759.1.35093 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012519759.1.35093
Domain Number 1 Region: 148-345
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.01e-56
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000000289
Further Details:      
 
Domain Number 2 Region: 429-563
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 5.1e-33
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00000116
Further Details:      
 
Domain Number 3 Region: 13-144
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.47e-26
Family Duplicated SiR/NiR-like domains 1 and 3 0.00029
Further Details:      
 
Domain Number 4 Region: 347-424
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.46e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0000595
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012519759.1.35093
Sequence length 573
Comment assimilatory sulfite reductase (NADPH) hemoprotein subunit [Alteromonas mediterranea]; AA=GCF_000020585.3; RF=na; TAX=1774373; STAX=314275; NAME=Alteromonas mediterranea DE; strain=DE; AL=Complete Genome; RT=Major
Sequence
MSNEKSPFIVEGKLADNERLKRESNNLRGTITTDLKDDLTGGFTADNFQLIRFHGMYQQD
DRDIRAERAKQKLEPLHNVMLRARLPGGVITPDQWLAIDKFADDHTMYGSIRLTTRQTFQ
FHGVLKPQIKLMHQTLNKVGIDSIATAGDVNRNVLCTSNPVESELHLHAYEWAKKISEHL
LPKTRAYAEIWLDGEKVETTEKPVEPILGDNYLPRKFKTTVVIPPQNDVDVHANDLNFVA
IAENGQLVGFNVLVGGGLAMTHGDKSTYPRKASDFGFIPLENTLDVAAAVVTTQRDWGNR
VNRKNAKTKYTLERVGVDNFKAEVEKRAGVTFQESRPYEFTDRGDRFGWVEGIDGKYHLT
VFIENGRILDYPGKTLKTGCAEIAKIHKGDFRLTANQNLIIAGVPPQDKDKIEALAREHG
LIAPSISNQRLDSMACVALPTCPLAMAEAERYLPDAVTELEGLLAKHGLEEDSVIFRVTG
CPNGCGRAMLSEVGLVGKGPGKYNLHLGGNREGTRIPRMYRENISEQEIMAELDTLLGQW
AKERDSGEAFGDYVVRAGVVKPVVDSARDFYDQ
Download sequence
Identical sequences B4RYS6 S5AH20 S5C6B8
gi|522651337|ref|YP_008193800.1| gi|522615601|ref|YP_008181291.1| gi|522816961|ref|YP_008185190.1| gi|332142731|ref|YP_004428469.1| 314275.MADE_03588 gi|410862996|ref|YP_006978230.1| WP_012519759.1.24997 WP_012519759.1.30323 WP_012519759.1.35093 WP_012519759.1.68468 WP_012519759.1.96561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]