SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012525262.1.49349 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012525262.1.49349
Domain Number 1 Region: 56-277
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.22e-33
Family GpdQ-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012525262.1.49349
Sequence length 282
Comment MULTISPECIES: metallophosphoesterase [Anaeromyxobacter]; AA=GCF_000020805.1; RF=na; TAX=447217; STAX=447217; NAME=Anaeromyxobacter sp. K; strain=K; AL=Complete Genome; RT=Major
Sequence
MDRFGRRQFLKGAALLGAAGAAGLVPAASSAAEPRLPDTDPVTFEVPGLDPAHDGLRIAQ
LSDLHVGPRTPSATVRAAIEDANAFAPDLVVLTGDYLSHSRRELAAMRDLLGGLVAPTIA
VLGNHDVWVDPDGAAGALKGHGYEVLENGWTSIRLRGAPLHVVGVGDHLTRRDDVQRAVK
GLPAGAAPLVLAHGPRTADKLRHLERPMVCLSGHTHGGQINIPILTPLFLASVAREPYVR
GRYQLGAVQLYVNRGIGMSGIRVRVNASPEVTLATLRRAEPA
Download sequence
Identical sequences B4UHK2 B8JGE6
gi|220916379|ref|YP_002491683.1| gi|197121615|ref|YP_002133566.1| 447217.AnaeK_1204 455488.A2cp1_1273 WP_012525262.1.49349 WP_012525262.1.98204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]