SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012536188.1.90948 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012536188.1.90948
Domain Number 1 Region: 3-271
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 2.16e-90
Family Methylenetetrahydrofolate reductase 0.000000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012536188.1.90948
Sequence length 272
Comment MULTISPECIES: methylenetetrahydrofolate reductase [NAD(P)H] [Bacteria]; AA=GCF_000020825.1; RF=na; TAX=380394; STAX=920; NAME=Acidithiobacillus ferrooxidans ATCC 53993; strain=ATCC 53993; AL=Complete Genome; RT=Major
Sequence
MAHSVEFFPPKNAAGEERLREAITALLPLGPEYASVTFGAGGSTRERTFATVTMIGQDYG
LEAVPHLSCIGSTEAGIREILEDYRKQGIRRIVALRGDLPEGMENPGHFQHAADLVAFIR
HFGGFEVYVAGYPDIHPRATSARDDVMHLAAKVRAGADAIITQYFFNPDAYLQLRDELRR
EGIEVPLVVGVMPITNFEQISRFSAMCGADIPQYLRRRMDAYAADPQSQYQLGIELLSRQ
CQLLLREGAPSLHFYTLNQAEATAAIWRNLGF
Download sequence
Identical sequences B5EN13 B7J554
gi|218665202|ref|YP_002425027.1| WP_012536188.1.13253 WP_012536188.1.28209 WP_012536188.1.49158 WP_012536188.1.50737 WP_012536188.1.90948 gi|198282829|ref|YP_002219150.1| 243159.AFE_0535 380394.Lferr_0692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]