SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012537326.1.90948 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012537326.1.90948
Domain Number 1 Region: 2-138,173-382
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.29e-99
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000016
Further Details:      
 
Domain Number 2 Region: 386-542
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.43e-37
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.000012
Further Details:      
 
Domain Number 3 Region: 573-677
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.37e-30
Family Myf domain 0.00018
Further Details:      
 
Domain Number 4 Region: 139-173
Classification Level Classification E-value
Superfamily Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00000000000222
Family Methionyl-tRNA synthetase (MetRS), Zn-domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012537326.1.90948
Sequence length 678
Comment MULTISPECIES: methionine--tRNA ligase [Bacteria]; AA=GCF_000020825.1; RF=na; TAX=380394; STAX=920; NAME=Acidithiobacillus ferrooxidans ATCC 53993; strain=ATCC 53993; AL=Complete Genome; RT=Major
Sequence
MKRRILITSALPYANGPIHLGHLVEYTQTDIWARYQRLRGHDCVYVCADDAHGTPIMLRA
QSEGITPEELITRMHGDHLRDFTGFGIRFDLYHSTHSPENFEISQSIYRALRAADYINVR
EIEQAYDPVAGIFLPDRFIRGTCPRCGAADQYGDSCEVCGATYSPTDLINPVSAVSGAVP
ERRNSEHYFFQLGDFSDFLRRWIHSGTLQEEVAHKLDEWFSIGLSDWDISRDAPYFGIPI
PDAPGKFFYVWLDALPGYMAATQHWCAAHGRNLADYWGPDSAAEIYHFIGKDIIYFHGLF
WPAMLKGSGHRLPTGIFAHGHLTVNGAKMSKSRGTSITARQYLQHLNPEFLRYYIATKLN
SHVEDIDLNLEDFLLRGNGDLVGKVVNLASRAAGFIHRSFAGRLAASLGKDQAFYDGLLQ
TQEAIGEAYAGREYGKAMRDIMALADQINAYVDQNAPWTLAKDPAQHESLHRVVTVTLNG
FRVLITLLSPVLPELSRKALEFLQCELDWAGLSKPLLDHQILPYSHLLQRMEKTQVDALI
QNPAESPATAPGTAAAPVPTPVPAEAREENPFIGIDDFSKVDLRIARIVAATNVDGADKL
LHLTLDIGEGTRSVFAGIKSAYDPASLVGRLTVMVANLAPRKMRFGLSEGMVLAASGPEG
GPFLLSPDSGAQPGMRVK
Download sequence
Identical sequences B5ENA8 B7J7Y5
WP_012537326.1.13253 WP_012537326.1.28209 WP_012537326.1.49158 WP_012537326.1.50737 WP_012537326.1.90948 243159.AFE_2672 380394.Lferr_2296 gi|198284383|ref|YP_002220704.1| gi|218666133|ref|YP_002427048.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]