SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012540146.1.6018 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012540146.1.6018
Domain Number 1 Region: 8-106
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 2.48e-33
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012540146.1.6018
Sequence length 110
Comment MULTISPECIES: molecular chaperone TorD [Klebsiella]; AA=GCF_000019565.1; RF=na; TAX=507522; STAX=573; NAME=Klebsiella pneumoniae 342; strain=342; AL=Complete Genome; RT=Major
Sequence
MDFDEDSMLDTEEVVMGIIVNAGHSRSLCYEALNHAKAGDFDHASKLLEMAAEAGKEAHA
IQTKLIEEDEGMGKTTMTLVMVHAQDHLMTSILCREMITELVQIYKSKLN
Download sequence
Identical sequences B5RK56
gi|206575595|ref|YP_002235780.1|NC_011282 gi|206575595|ref|YP_002235780.1| 507522.KPK_A0132 WP_012540146.1.55984 WP_012540146.1.6018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]