SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012547028.1.10127 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012547028.1.10127
Domain Number 1 Region: 202-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 5.23e-71
Family B3/B4 domain of PheRS, PheT 0.00000928
Further Details:      
 
Domain Number 2 Region: 467-692
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000731
Further Details:      
 
Domain Number 3 Region: 41-187
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6e-36
Family Myf domain 0.0051
Further Details:      
 
Domain Number 4 Region: 699-797
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 4.05e-25
Family Anticodon-binding domain of PheRS 0.00048
Further Details:      
 
Domain Number 5 Region: 404-475
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.84e-20
Family Domains B1 and B5 of PheRS-beta, PheT 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012547028.1.10127
Sequence length 799
Comment phenylalanine--tRNA ligase subunit beta [Dictyoglomus thermophilum]; AA=GCF_000020965.1; RF=representative genome; TAX=309799; STAX=14; NAME=Dictyoglomus thermophilum H-6-12; strain=H-6-12; ATCC 35947; AL=Complete Genome; RT=Major
Sequence
MLVSYRWLMDYLEEEIPVKEVINALRNLGLYGTIQKSIGANWDKIIIGEIKSIEKHPHSE
NLLICKVDVGEKLLNIVTGAKNVFVGAKVPVALPGVEILGEVIGIREFNGIKSEGMLCSE
YELEFSEDKEGIMILPEDFKIGSTFDTYFGKGDFLIDVEVPSNRGDCLSYLGIAREISGY
FGVPLKFEFKKAQEKDDISIKDFASCEVLDFDLCPRFTLRFIKDVKIGPSPLWLRWRLER
VGLRSINNVVDITNFIMLETGQPLHAYDFDLLKGGKLIVRRAKEGEKIVLINGEEKILDN
DILVIADAERAVGIGGIMGGKDTEINDNTKNVLLEAAYFSPVNIRRSARKLGIRTDASLR
FERNVDIHRTADILDYAAEMIRLVAGGDIAKDKIDINKGLPSLTKVFLRPERVNKILGTN
LKEDEIVRILSKIGFDIKSRNPVLEIEVPSYRQDIKEEIDLIEEVARFYGYNNIPSVPLQ
KGHIVDPPLTEEIIERRIRETLPSLGLYEAINYSFMSVKDLEKAGILNTEPFNLFIQISN
PLSEENSVLRTSLLPSLLNVAQVNSNRQQKDVFVYEIGKVFYKGKDEYIEEKHLGILMTG
EAYKDPWSVPYEIRKVDFYDLKGIVETIFERIWKEEPTFKKSNFEFMHPSKQSYIAFRDE
IVGFMGEVNPWITQNLDIRERVYFAEINLDKLNFESPKPKYKPLPIYPGIRRDLALIIPE
DMPVENVEKDILETSGELLKWLRIFDLYQGEKIEKGYKSITFSLFFLAEDHTLEDKEVDE
IINKVLIKLSEKGVYLRQK
Download sequence
Identical sequences B5YER4
gi|206900235|ref|YP_002251022.1| 309799.DICTH_1193 WP_012547028.1.10127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]