SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012562093.1.50963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012562093.1.50963
Domain Number - Region: 88-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0157
Family NfeD domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012562093.1.50963
Sequence length 145
Comment membrane protein [Oligotropha carboxidovorans]; AA=GCF_000218585.1; RF=na; TAX=1031710; STAX=40137; NAME=Oligotropha carboxidovorans OM4; strain=OM4; AL=Complete Genome; RT=Major
Sequence
MIDLAIKLGSWNWLILGVLLMGIEALAPGVFMLWLGLAALIVGLLSFLFVASWQMQVVAF
ALISIAMVPLWRHFARREAVDNNFLNRRTKGLVGQVVTLESAIVDGVGSIRLGDTTWRVE
GPPLAAGTKVRIVEADGARLRVGPA
Download sequence
Identical sequences B6JAY9
gi|337742228|ref|YP_004633956.1| WP_012562093.1.10663 WP_012562093.1.50963 WP_012562093.1.53695 gi|337742228|ref|YP_004633956.1| gi|386031193|ref|YP_005951968.1| 504832.OCAR_4926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]