SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012563343.1.50963 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012563343.1.50963
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily YccV-like 3.53e-32
Family YccV-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012563343.1.50963
Sequence length 109
Comment DNA-binding protein [Oligotropha carboxidovorans]; AA=GCF_000218585.1; RF=na; TAX=1031710; STAX=40137; NAME=Oligotropha carboxidovorans OM4; strain=OM4; AL=Complete Genome; RT=Major
Sequence
MKVRSTKFHIGQIVRHRVFSFRGVIFDIDGEFNNTEEWWLSIPEELRPEKDQPFYHLLAE
NAESEYIAYVSEQNLLPDETGDPVGHSQVSEIFIKDKTGSYRQRNLSLN
Download sequence
Identical sequences B6JF98
gi|337741054|ref|YP_004632782.1| gi|337741054|ref|YP_004632782.1| 504832.OCAR_6203 gi|386030071|ref|YP_005950846.1| WP_012563343.1.10663 WP_012563343.1.50963 WP_012563343.1.53695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]