SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012569805.1.72017 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012569805.1.72017
Domain Number 1 Region: 39-218
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.24e-25
Family Clp protease, ClpP subunit 0.09
Further Details:      
 
Domain Number 2 Region: 391-456
Classification Level Classification E-value
Superfamily NfeD domain-like 2.48e-16
Family NfeD domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012569805.1.72017
Sequence length 458
Comment serine protease [Coxiella burnetii]; AA=GCF_000751935.1; RF=na; TAX=227377; STAX=777; NAME=Coxiella burnetii RSA 493; AL=Contig; RT=Major
Sequence
MYCRKRIFIRCFYILIFTFGLLGIASHIIAQNNTRRLAILIDIKGGIGPATADFFHRSLK
QATEKKAQVIILQLDTPGGLATAMRDIIKDILASPIPVIGYVAPSGAHAASAGTYVLYAT
HIAAMAPGTNLGAATPIAIGTPGGSSPEKGNEKKEGAKKAPAQKTAAEKKAISDARAYIR
SLAQLRGRNVEWAESAVVEAESLSAEEAYKIKVINIIASNIPNLLEQANGMKISVRGETQ
TVNTANLEIEKVEPDWRTRFLSVITDPSVAYILLMIGFYGIFFEFINPGFIVPGVVGAIS
LLLALYAFQLLPINYAGLALILLGLAFIVAEAFMPSFGMLGIGGGVAFVIGSIMLMRTDA
IGFGIPMYLIIAIAIVTIAFFLLVLSIAFRSRGRPIVSGREAVIGKRGVVNVSDKRMWVR
IEGERWQCKSDVPLQDGDEVVVERLEGLFCVVKPVEKK
Download sequence
Identical sequences gi|212212151|ref|YP_002303087.1| 434923.CbuG_0523 WP_012569805.1.38839 WP_012569805.1.6787 WP_012569805.1.72017 WP_012569805.1.9866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]