SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012592832.1.32329 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012592832.1.32329
Domain Number 1 Region: 459-560
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000471
Family Anti-sigma factor antagonist SpoIIaa 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012592832.1.32329
Sequence length 573
Comment sulfate transporter [Methylocella silvestris]; AA=GCF_000021745.1; RF=representative genome; TAX=395965; STAX=199596; NAME=Methylocella silvestris BL2; strain=BL2; AL=Complete Genome; RT=Major
Sequence
MDRSMTTAAIAPSFAALFTPKLVTVLRERYGLADFRADVIAGLTVAIVALPLSMAIAIAS
GVTPDRGLYTAIVGGFFVSLLGGSRFQIGGPAGAFIVLVATTVAIHGVDGLIIATFLSGI
ILLSIGFLRLGAFIKFIPYPVTVGFSAGIATIIFASQIKDLLGLTLSGPEPGPLFEKLGA
LGAALPSLSLPAFCVSGATIAIILLVRRYRPHWPGMLIAVAVASLAGFALALPIDTIGSH
FGGIPRGLPAPSLPALSLDRIVTLLPVAFSFALLGSIESLLSAVVADSMSGRRHRSNCEL
VAQGVANMASALFGGICVTGTIARTATNVRSGARSPIAGMLHAAFLLLFMLVAAPLASYI
PLAALAGVLAIVAWNMAEQHAFTTLIRASRGDAVVLLATFLLTIFRDLTTGILAGFSLAS
LVFMRRMSQSLQVEAVGTFGPDDEGDAGENGAGYGALTSDRDIVAFKISGAFFFGAAAGV
SAVLDEIAEQPKAFIIDLSAVSALDSTAAAAIGDFAAKAHRRGAFVYISGASKVVRRALL
MSTDGVRRVRFKDDIRTAAAAARAAIGAPPAPV
Download sequence
Identical sequences B8EMT5
395965.Msil_3882 WP_012592832.1.32329 gi|217979979|ref|YP_002364126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]