SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012595225.1.93053 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012595225.1.93053
Domain Number 1 Region: 28-119
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.83e-27
Family Pentapeptide repeats 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012595225.1.93053
Sequence length 149
Comment MULTISPECIES: hypothetical protein [Cyanothece]; AA=GCF_000021805.1; RF=na; TAX=41431; STAX=41431; NAME=Cyanothece sp. PCC 8801; strain=PCC 8801; AL=Complete Genome; RT=Major
Sequence
MNDEQLSIIQKGAIAWNVWRKQNAKDKIDLMKANLKDARLINVDLREAKLIKTDLRKANL
FKANLSKANLFRADLREANLLKTNFKGANLFGVDFAKANLLEADFEGANVKGTNFRGAIN
LRAEQIQVAIFWQEAMYDEPFRKKLGLSK
Download sequence
Identical sequences B7JXY9
gi|257059779|ref|YP_003137667.1| WP_012595225.1.62203 WP_012595225.1.93053 gi|218246738|ref|YP_002372109.1| 395962.Cyan8802_1941 41431.PCC8801_1915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]