SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012608266.1.40753 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012608266.1.40753
Domain Number 1 Region: 233-374
Classification Level Classification E-value
Superfamily vWA-like 0.0000731
Family Integrin A (or I) domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012608266.1.40753
Sequence length 439
Comment DUF58 domain-containing protein [Desulfurococcus amylolyticus]; AA=GCF_000020905.1; RF=representative genome; TAX=490899; STAX=94694; NAME=Desulfurococcus amylolyticus 1221n; strain=1221n; AL=Complete Genome; RT=Major
Sequence
MAIHATTRLRLYMLSTALLLAGAIIVDPTFLPPALLLLSLPVFSYIAIESNYKILKSIKV
SGSVAMETGGRFFVEYTIINPTRIPILPVEFSIQYSELIKLVKGSKRGLLIIPPRAKVKL
RFSFHGRLGEHFVGPLKIVLRDLFGFYRSSDEYLGKALVVNIPPTVEEVIVRKLLIYARS
TGLVKSRIPGEGVEFYDIRDYSPGDEAKRIVWRIYASRRMLAIWEPEKEVFQPVLFILDG
TREMWSGPMSQSMIEHSARIISSIIYYLVKRGYPVSATVFNESLVHTSGKPMHGYHGYME
ALRVLSKVKFEEGDESHRRRALSGVLSYTYTRILPRDRSIIFLFTHLRDTIIDEIAAWNN
LYKDKGHILYIVHPLITAYESDSDVPEWVANIYRVKLIENLREDMAVISRARGRGLKVIA
VTPDLIPQRVMDIIERYSS
Download sequence
Identical sequences B8D494
490899.DKAM_0599 WP_012608266.1.40753 gi|218883910|ref|YP_002428292.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]