SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012609294.1.94734 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012609294.1.94734
Domain Number 1 Region: 233-274,307-335,427-628
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 4.01e-45
Family CoA transferase alpha subunit-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012609294.1.94734
Sequence length 728
Comment MULTISPECIES: hypothetical protein [Desulfatibacillum]; AA=GCF_000429905.1; RF=representative genome; TAX=1121392; STAX=218208; NAME=Desulfatibacillum aliphaticivorans DSM 15576; strain=DSM 15576; AL=Scaffold; RT=Major
Sequence
MADNQPTFYDDVEKCADDIIRIMGKRVNFAMPLALGKSYHLTNELYRRAKEDPEIQLTFV
TALALEKPTWSSDLEKRLVKPMRERIWKGVPDFDYVLDMRKNALPKNVVVTEFFFKAGSY
NNVPMAQQNHSSSNYTHAIRDITNCFDTLVACQCVCKGEIDGETVYSNSCNSDLAYEIYP
SKLEAERMGKKVIYIGHVNDTLPFMYGDAVEPEHHFDMILDSPKYCFPLFSAPKAPVCTK
DYMIGLHVSSLIKDGGTLQIGIGTLGDAIASGLLMRHHNNGDYNQLLDDLGINNRYSRLI
DKIGGRDEFAQGLYGATEMLVDVFIELYTGGIIKRNVYHNIPLMRMINDGALQEEFTPES
VKELLLQDEHFPILKEQDFISLRNYGIFKDDLRYEDYHLVNGAGKYSVDFRDSANLDAVL
ENCLGDRLKNGVVLTGSFFIGPNGFYDFLRDMSDEERKKFEMTGVKVVNQLYGDEVLRSL
ERKDARFVNAGMKISLMGNVASDALRNGTVISGVGGQYNFVSMAHALPDARLIMMLRSTK
ETPKEVKSNILFNYGYTTIPRHLRDIVVTEYGIADLRSKQDWVVMTELIKVADSRFQDEL
LDEAKKAGKVPMDYEIPYEYRNNYPDQLEKKLAPFKAKGYFKPFPFGKEFTDEEVALGAS
LRKFKGGMTANKFKASKALIKDFKAPVPPEATPYLKRMNLDAPKGVKEKLMQKLVVHALS
NAGYVKLQ
Download sequence
Identical sequences B8FMI7
439235.Dalk_0144 WP_012609294.1.12191 WP_012609294.1.94734 gi|218778004|ref|YP_002429322.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]