SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012617013.1.75456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012617013.1.75456
Domain Number 1 Region: 240-579
Classification Level Classification E-value
Superfamily SIS domain 6.78e-95
Family double-SIS domain 0.000000932
Further Details:      
 
Domain Number 2 Region: 2-219
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.89e-66
Family Class II glutamine amidotransferases 0.00000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012617013.1.75456
Sequence length 579
Comment glutamine--fructose-6-phosphate aminotransferase [Methanosphaerula palustris]; AA=GCF_000021965.1; RF=representative genome; TAX=521011; STAX=475088; NAME=Methanosphaerula palustris E1-9c; strain=E1-9c; AL=Complete Genome; RT=Major
Sequence
MCGIVGYIGFRRAAPVVVNGLKKLEYRGYDSFGIAVNNPKMQVFKKEGRISKNEKAASRL
PGHIAIGHTRWATHGIPNDINAHPHQDCTKKIAVVHNGIIENYAELKRQLIGRGHTFISE
TDTEVIAHLIEEAYKGDLQAAVYQAIQYLQGSYALLVTVEGEDKIVAARDSSPLVLGVGD
GEFFAASDVTPLLEFTERVIYLEDGDLATLTPEKSEIFHNGVPVERSIELIDWSIENVKK
GGFEHYMLKEIYEQPQVFYNTMMGITPDQIPPELKQSDEVTVVACGSSYHTGLIFKYLLE
SICRIPVRAELGSEFKYFTPPIKGLVMVITQSGETADTLAALKKAKAYNCPTLAITNVLG
STVTRMADHTLFMRAGPEISVAATKSFIAQLAVLMQIANLLHDGDLTGVLTHANSVIEEA
LLTDTKKAVEICSPAEHIFYVGRGLFYPIALEGALKMKEISYIHAEGYAAGELKHGPFAL
LSPQTPVVALCSPGNTYPVMVSNIKEMKARGAPIIAIGVNGDLELSEIVDVFIPIPESHE
LVQVLATSVVLQMLAYHTAVALNRDIDKPRNLAKSVTVE
Download sequence
Identical sequences B8GJP0
gi|219850985|ref|YP_002465417.1| WP_012617013.1.75456 521011.Mpal_0312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]