SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012636459.1.20074 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012636459.1.20074
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.14e-29
Family YheA-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012636459.1.20074
Sequence length 111
Comment hypothetical protein [Halothermothrix orenii]; AA=GCF_000020485.1; RF=representative genome; TAX=373903; STAX=31909; NAME=Halothermothrix orenii H 168; strain=H 168; DSM 9562; AL=Complete Genome; RT=Major
Sequence
MSIIKKAEELGKEIVDSAEYKELKSTEEAMQNDKEAQSLLNEFRSKQQRLQMAQANGKNI
TEDQKKELMALQARMQENEKIKNFMTAQQKFNQVMQTVNQAITGIIAGQHA
Download sequence
Identical sequences B8CYA7
gi|220932363|ref|YP_002509271.1| WP_012636459.1.20074 373903.Hore_15270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]