SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012642772.1.69661 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012642772.1.69661
Domain Number 1 Region: 1-402
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.09e-96
Family Phase 1 flagellin 0.0000137
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012642772.1.69661
Sequence length 402
Comment flagellin [Thermomicrobium roseum]; AA=GCF_000021685.1; RF=representative genome; TAX=309801; STAX=500; NAME=Thermomicrobium roseum DSM 5159; strain=DSM 5159; AL=Complete Genome; RT=Major
Sequence
MRIYNNVNAVNAQRNLSITGFALAKSIEKLSSGLRINRAADDAAGLSISEKLRAQIRGVM
QAMRNAQDGVSMIQTAEGALNEVHSMLQRMRELAVQAANDTLTTEDRRAIYQELDNLRVE
VDAIVARTSFNGKNLLDGTLVTTVAAGSEIKVGTTLTGGGETAHVFALDVSGAVPGRTYT
FSYNSTTDTLTLTRSGDNVSQSITISNIAAGGSQVLNFSALGIKLTVTSTGGITADNLGA
ALTAGATDTITTHNGGGSANMQVGPNSTHSFNVNFSDVRVSGTASAMTTLDSAITAFSTS
LSGLNSAQVTAAQNLINALDGAISYVNEVRSYLGAVQNRLEHAIANLGVQHENLTASESR
IRDVDMAKEMVIFTRNQILQQAGVAVLSQANAMPQSVLQLLR
Download sequence
Identical sequences B9L344
WP_012642772.1.69661 gi|221635614|ref|YP_002523490.1| gi|221635614|ref|YP_002523490.1|NC_011961 309801.trd_A0208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]