SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012643143.1.69661 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012643143.1.69661
Domain Number 1 Region: 148-461
Classification Level Classification E-value
Superfamily Phase 1 flagellin 1.28e-25
Family Phase 1 flagellin 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012643143.1.69661
Sequence length 468
Comment flagellar hook-associated protein FlgK [Thermomicrobium roseum]; AA=GCF_000021685.1; RF=representative genome; TAX=309801; STAX=500; NAME=Thermomicrobium roseum DSM 5159; strain=DSM 5159; AL=Complete Genome; RT=Major
Sequence
MVFRALETAFRGLMAQQRVVDTANHNIANANTPGFARQRVSLVPSMPYTVPAFNRSGLAG
QVGTGVLVASITRVRESVFDLQYRVQSQALGEASTLVDAYAQIEAVFNEPTEAGLGTLLD
RFWRAWQAVGNQPEDLAARAALVQDATTLATNLNRMRRQLTELQADTVTKLTLQVSEVNS
IAERLASLNQQIVAALATGQTPNDLMDQRDLLLDKLARFTGATIRPLPNGAVNIYLGGYP
LVDQDQWFPLSVQVSGGTASVLWQGTTSPVALERGSLQALLHLHNAVLPGLVQKLEDIRD
ALANEVNTLHMTGYGLSDLPGPPPGRPFFRITAGGELEVEPSLVADPQLIAAADAPGEPG
NNAIARQIAELRSKLVLNSGTATINDFYNTLVAEVGGASQTAQVTRDNQRALVEAIDRQR
QEIMAVSLDEEMANLIKYQQAYGAAARAITAVDEMLDRIINGMGLVGR
Download sequence
Identical sequences B9L5C1
gi|221635454|ref|YP_002523330.1| WP_012643143.1.69661 gi|221635454|ref|YP_002523330.1|NC_011961 309801.trd_A0048

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]