SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012643165.1.69661 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012643165.1.69661
Domain Number - Region: 108-146
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.017
Family Phase 1 flagellin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012643165.1.69661
Sequence length 151
Comment flagellar basal body rod protein FlgC [Thermomicrobium roseum]; AA=GCF_000021685.1; RF=representative genome; TAX=309801; STAX=500; NAME=Thermomicrobium roseum DSM 5159; strain=DSM 5159; AL=Complete Genome; RT=Major
Sequence
MGILETMRVSLSALTAQRVRMDVTASNLANVDTTRTPQGGPYLRRQVVFATEQPSPFARL
VQTRTGLVETTPSAGRGVQVAGIVVDRRAVREVYDPTHPDADANGIVRYPDIDVVSEMTN
LMAATRAYEANVTVLDALKTMAMRALSIGRA
Download sequence
Identical sequences B9L4D9
309801.trd_A0653 gi|221636059|ref|YP_002523935.1| gi|221636059|ref|YP_002523935.1|NC_011961 WP_012643165.1.69661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]