SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012647784.1.88144 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012647784.1.88144
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000209
Family NfeD domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012647784.1.88144
Sequence length 152
Comment NfeD family protein [Geobacter daltonii]; AA=GCF_000022265.1; RF=representative genome; TAX=316067; STAX=1203471; NAME=Geobacter daltonii FRC-32; strain=FRC-32; AL=Complete Genome; RT=Major
Sequence
MNILWWHWLVLGLVLIGLELVVPSFTIIWFGLGAILVSIFLAIYPTFSLPLQILTWSVAS
IVFTFVWFRFFNPRTSKTFSGSAKGTVLGETGLVIRGAEPYTKGTVKFQLPLLGADEWPC
MADEPLEIGDRVKVVNVEGHVMKVTKLKKGES
Download sequence
Identical sequences B9M1H4
WP_012647784.1.88144 316067.Geob_2706 gi|222055795|ref|YP_002538157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]