SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012650058.1.91008 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012650058.1.91008
Domain Number 1 Region: 123-380
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 4.02e-50
Family D-glucarate dehydratase-like 0.00000000593
Further Details:      
 
Domain Number 2 Region: 1-137
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 4.18e-26
Family Enolase N-terminal domain-like 0.000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012650058.1.91008
Sequence length 387
Comment mandelate racemase [Agrobacterium tumefaciens]; AA=GCF_000016265.1; RF=na; TAX=311403; STAX=358; NAME=Agrobacterium radiobacter K84; strain=K84; AL=Complete Genome; RT=Major
Sequence
MRILDICEVTKPIASPIRNAYIDFSKMTASLVAIVTDVVRDGRRVVGYGFNSNGRYGQGG
LIRERFKDRILEASPESLMNDAGTNLDPHKIWATMMMNEKPGGHGERSVAVGTLDMAIWD
AVAKIEGKPLFRHLAELKGREANPKVFVYAAGGYYYPGKDNSALRKEMRSYLDRGYNVVK
MKIGGASIDEDRGRIESVLEEIGSQARLAVDANGRFDLETGIAYAKMLRDYPLFWYEEIG
DPLDYALQAAISEFYDAPMATGENLFSHQDARNLLRYGGMRADRDFLQFDCALSYGLVEY
LRTLDVLHQFGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPYGGFPDGVNVIDG
HITMPELPGIGFEGKSDLIKVMRELAE
Download sequence
Identical sequences B9JIP3
311403.Arad_8540 gi|222082017|ref|YP_002541382.1| WP_012650058.1.91008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]