SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012660096.1.80915 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012660096.1.80915
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily Transposase IS200-like 2.09e-39
Family Transposase IS200-like 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012660096.1.80915
Sequence length 129
Comment IS200/IS605 family transposase ISHla21 [Halorubrum lacusprofundi]; AA=GCF_002215285.1; RF=na; TAX=2247; STAX=2247; NAME=Halorubrum lacusprofundi; strain=HLS1; AL=Scaffold; RT=Major
Sequence
MKTTRHATYNLNYHLVWLPKYRNSVLVNEVADRVRTILHEIADDKGLEILDLTVQPDHVH
LFVSSPPKHAPSLLANWFKGISSRKYNHRYADHDGEKIGWVRGYYAGTAGHVSSETVKNY
IQRHEEDES
Download sequence
Identical sequences B9LW92
WP_012660096.1.44229 WP_012660096.1.66911 WP_012660096.1.80915 gi|222475847|ref|YP_002564368.1| gi|222481246|ref|YP_002567482.1| gi|222481246|ref|YP_002567482.1|NC_012030 416348.Hlac_2929 416348.Hlac_3365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]