SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012662308.1.86244 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012662308.1.86244
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 4.45e-26
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012662308.1.86244
Sequence length 115
Comment PTS chitobiose transporter subunit IIA [Borreliella burgdorferi]; AA=GCF_000172335.2; RF=na; TAX=498740; STAX=139; NAME=Borrelia burgdorferi 64b; strain=64b; AL=Contig; RT=Major
Sequence
MNKKIYSIEELIDKISMPVVAYSGEAKSFLREALEYAKNKEYDKAELTIQESKKSIAKAH
EVHREIIHQSATNPNSVKTPFILIHAEDHLMSAISELSIFEELINVYKIINEIKK
Download sequence
Identical sequences A0A0E0STP8
gi|223987649|ref|YP_002601102.1|NC_012104 WP_012662308.1.86244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]