SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012676291.1.53201 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012676291.1.53201
Domain Number 1 Region: 1-289
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.06e-107
Family Methylenetetrahydrofolate reductase 0.0000000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012676291.1.53201
Sequence length 293
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Persephonella marina]; AA=GCF_000021565.1; RF=representative genome; TAX=123214; STAX=309805; NAME=Persephonella marina EX-H1; strain=EX-H1; AL=Complete Genome; RT=Major
Sequence
MKIGEILKHINTSISFEFFPPKTPEGEDQLFRTIKDLEKLNPTFVSVTYGAGGSTRERTI
RVVKRIHEQCNLTVMAHLTCIGHSKKEIYDILKGYKDIGIQNILALRGDIPQGQEESFVF
PPDGCRYANELVSFIREQFGDYFSIGVAAYPEGHPESPSLEKDIYYFKKKVEAGAEFAIT
QMFFDNSYFYRYMDLLSKEGINIPVIPGIMPITNFRQIEKFAVMCGATIPKDLVEKLEKV
ENSPEEVAKIGIDYATEQCEDLLKNGVKGLHFYTLNKSKATVEIYRRIKDLIK
Download sequence
Identical sequences C0QT51
WP_012676291.1.53201 gi|225849632|ref|YP_002729866.1| 123214.PERMA_0068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]