SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012676520.1.53201 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012676520.1.53201
Domain Number 1 Region: 8-152
Classification Level Classification E-value
Superfamily PEBP-like 1.1e-46
Family Prokaryotic PEBP-like proteins 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012676520.1.53201
Sequence length 154
Comment hypothetical protein [Persephonella marina]; AA=GCF_000021565.1; RF=representative genome; TAX=123214; STAX=309805; NAME=Persephonella marina EX-H1; strain=EX-H1; AL=Complete Genome; RT=Major
Sequence
MEPIIVKSMSFDEGEPIPVDYTCDGMDISPEIVWDNVPEETKSFVLIMEDPDAPMGVFTH
WVVYDIPSSLRLLPENFPKVPQIDGIKQGINDFGRIGYGGPCPPRGSTHRYVFNVYAISV
VSLELPTGATKKIVEERMEGKILSKGKLTGIYGR
Download sequence
Identical sequences C0QPT6
WP_012676520.1.53201 123214.PERMA_0895 gi|225850448|ref|YP_002730682.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]