SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012680701.1.62785 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012680701.1.62785
Domain Number 1 Region: 139-426
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.64e-129
Family Enolase 0.00000000663
Further Details:      
 
Domain Number 2 Region: 3-138
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 8.61e-57
Family Enolase N-terminal domain-like 0.00000364
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012680701.1.62785
Sequence length 430
Comment enolase [Acidobacterium capsulatum]; AA=GCF_000022565.1; RF=representative genome; TAX=240015; STAX=33075; NAME=Acidobacterium capsulatum ATCC 51196; strain=ATCC 51196; AL=Complete Genome; RT=Major
Sequence
MTEIAAIHAREILDSRGNPTVEADVLLADGTLGRAAVPSGASTGEHEAVELRDGDKSHYL
GKGVLKAVDNIESVIAPELEGMDAANQRLLDATMIALDGTPNKGRLGANAILAVSMAAAR
ASANSLKIPLYRYLGGANASILPTPMMNILNGGAHADNNVDFQEFMVMPVGAERFSEALR
WGAEIFHTLKGVLKKKGYNTAVGDEGGFAPSLSSNTEAIEVILEAIELAGYKAGEDVAIA
LDPAASEFYDKEKGKYIFKKSDKSEKTSEEMAQYWESWTRQYPIISIEDGFAEDDWQGWR
YFTELVGSRIQLVGDDLFVTNTERLQRGIEEGIANSILIKVNQIGTVSETFEAIELGRRY
GYTSIISHRSGETEDTFIADLAVATGAGQIKTGSASRTDRIAKYNQLLRIEEQLGQTGEF
LGLEAVNFGE
Download sequence
Identical sequences C1F9E6
240015.ACP_0300 WP_012680701.1.62785 gi|225871989|ref|YP_002753443.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]