SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012685268.1.45054 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012685268.1.45054
Domain Number 1 Region: 4-339
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 7.85e-97
Family DmpA-like 0.00000262
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012685268.1.45054
Sequence length 352
Comment D-aminopeptidase [Brevibacillus brevis]; AA=GCF_000010165.1; RF=representative genome; TAX=358681; STAX=1393; NAME=Brevibacillus brevis NBRC 100599; strain=NBRC 100599 (= 47); AL=Complete Genome; RT=Major
Sequence
MTKKMRQLSATISRLPVGEKNDITDVAGVRVGHVTIQHELDNDDYACTGVTAILPHGGSL
FREKVTAASYVINGFGKTTGLVQVNELGVLESPIMLTNTFSVPAVTQGTLQYMLDTNEEI
GDTTGTINIVVGECNDGHLNSIRRCVVRPEDAREAIQNATDQAVEEGAVGAGTGMIAFGY
KGGIGSSSRIVVAEGHTYTLGSLVLSNFGNKNDFLGANLFTSCKSYENAVEKSEDGSIII
VLATDAPLSDRQLLRVAKRAGIGLGRTGSHFGHGSGDIVIAFSTAQKIPHQTTTITETRV
QLREDHPIMNELFAAAAEATEEAIYHSLAQAVTTTGRKGRIVHAYPSQGLGQ
Download sequence
Identical sequences C0Z949
gi|226311129|ref|YP_002771023.1| 358681.BBR47_15420 WP_012685268.1.45054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]