SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012692710.1.1337 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012692710.1.1337
Domain Number 1 Region: 91-151
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000902
Family NfeD domain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012692710.1.1337
Sequence length 155
Comment membrane protein [Deinococcus deserti]; AA=GCF_000020685.1; RF=representative genome; TAX=546414; STAX=310783; NAME=Deinococcus deserti VCD115; strain=VCD115; AL=Complete Genome; RT=Major
Sequence
MDWLPTLERIQSWHWWVLGALLLILEVFAPGVFFVWLAMAAFMLGLLVFVLPLPVTLQLL
LFALLSVVAVLIGRRYVNRLILGGDEGESMNRGASRLVGRTVVVTSAIRNGVGRVRVGDS
DWRATGPDVPEGANVLIVSAEGTTLHVREINGTWV
Download sequence
Identical sequences C1D163
WP_012692710.1.1337 gi|226355601|ref|YP_002785341.1| 546414.Deide_07290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]