SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012702474.1.101714 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012702474.1.101714
Domain Number 1 Region: 192-328
Classification Level Classification E-value
Superfamily CBS-domain pair 3.28e-29
Family CBS-domain pair 0.0042
Further Details:      
 
Domain Number 2 Region: 337-422
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3e-21
Family CorC/HlyC domain-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012702474.1.101714
Sequence length 426
Comment HlyC/CorC family transporter [Azotobacter vinelandii]; AA=GCF_000380335.1; RF=representative genome; TAX=1283330; STAX=354; NAME=Azotobacter vinelandii CA; strain=CA; AL=Complete Genome; RT=Major
Sequence
MEALHPGYLIGLLIFLLACSAFFSSAETGLLSLNRHRLRHHAEKGHRGAQRAKALLEHPD
RLLGTILIGNNFVNILASAIATVLATRLWGEVGIAIATLGATLALLIFGEITPKTLAAIR
PELVAYPFSRPLAQLQKILYPLVILLGWISNGLLRLAGIAPQGKGSASLTSEELRSMLHE
SGETLSPNRRGMLLGILDLERVSVNDIMIPRNEVVGLDLDETMEAMVELLRSTSHTRLPV
FRGDINRIEGVVHMRHIAHLLTRNRLTKENLREACQEPYFVPENTPLAVQLIQFQQQKRR
IAIVVDEYGDVQGIVTLEDILGEIVGEFTNRDHQFAPDIRAQEDGSQIIDGAAHVREVNK
TLGWQLPSDGPRTLNGLITEALQNIPDCGVCLSIGPYRLEILETSGNRVKNVRVWTADAR
PSPTHE
Download sequence
Identical sequences C1DDZ1 M9YIB7
322710.Avin_39600 gi|482894554|ref|YP_007894881.1| gi|482901759|ref|YP_007899930.1| gi|226946001|ref|YP_002801074.1| WP_012702474.1.101714 WP_012702474.1.69821 WP_012702474.1.78925 WP_012702474.1.92556 WP_012702474.1.99604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]