SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012702474.1.69821 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012702474.1.69821
Domain Number 1 Region: 192-328
Classification Level Classification E-value
Superfamily CBS-domain pair 3.28e-29
Family CBS-domain pair 0.0042
Further Details:      
 
Domain Number 2 Region: 337-422
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 3e-21
Family CorC/HlyC domain-like 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012702474.1.69821
Sequence length 426
Comment membrane protein [Azotobacter vinelandii]; AA=GCF_900119555.1; RF=na; TAX=354; STAX=354; NAME=Azotobacter vinelandii; strain=DSM 279; AL=Scaffold; RT=Major
Sequence
MEALHPGYLIGLLIFLLACSAFFSSAETGLLSLNRHRLRHHAEKGHRGAQRAKALLEHPD
RLLGTILIGNNFVNILASAIATVLATRLWGEVGIAIATLGATLALLIFGEITPKTLAAIR
PELVAYPFSRPLAQLQKILYPLVILLGWISNGLLRLAGIAPQGKGSASLTSEELRSMLHE
SGETLSPNRRGMLLGILDLERVSVNDIMIPRNEVVGLDLDETMEAMVELLRSTSHTRLPV
FRGDINRIEGVVHMRHIAHLLTRNRLTKENLREACQEPYFVPENTPLAVQLIQFQQQKRR
IAIVVDEYGDVQGIVTLEDILGEIVGEFTNRDHQFAPDIRAQEDGSQIIDGAAHVREVNK
TLGWQLPSDGPRTLNGLITEALQNIPDCGVCLSIGPYRLEILETSGNRVKNVRVWTADAR
PSPTHE
Download sequence
Identical sequences C1DDZ1 M9YIB7
WP_012702474.1.101714 WP_012702474.1.69821 WP_012702474.1.78925 WP_012702474.1.92556 WP_012702474.1.99604 gi|226946001|ref|YP_002801074.1| gi|482894554|ref|YP_007894881.1| 322710.Avin_39600 gi|482901759|ref|YP_007899930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]