SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012710361.1.91160 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012710361.1.91160
Domain Number 1 Region: 3-170
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.31e-68
Family Inorganic pyrophosphatase 0.00000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012710361.1.91160
Sequence length 172
Comment inorganic pyrophosphatase [Sulfolobus islandicus]; AA=GCF_000364745.1; RF=na; TAX=1241935; STAX=43080; NAME=Sulfolobus islandicus LAL14/1; strain=LAL14/1; AL=Complete Genome; RT=Major
Sequence
MKLGPGKKAPDEVNVFIEIPMGSNIKYEYDEEGEVIKVDRVLYTSMVYPFNYGFIPETLE
EDGDPLDVLVLGNYSLMPGTVIEARPIGMIYMRDEEGEDAKVIAVPRNKTDPSFSNINDV
KDLPEATRNKIVHFFEHYKELEPNKWVKISGWGGVAEAKERIKKAIDRKKQG
Download sequence
Identical sequences C3MK71 C3MU40 C3N128 C3N8P0 C3NMB1 C4KK95 D2PEN1 F0NBD1 F0NJ47 M9UBT6
gi|229583757|ref|YP_002842258.1| 419942.YN1551_2789 426118.M164_0202 427317.M1425_0183 427318.M1627_0183 429572.LS215_0214 439386.YG5714_0187 gi|385774924|ref|YP_005647492.1| gi|238618679|ref|YP_002913504.1| gi|284996590|ref|YP_003418357.1| gi|479324605|ref|YP_007864653.1| gi|229578004|ref|YP_002836402.1| gi|227826593|ref|YP_002828372.1| gi|385772209|ref|YP_005644775.1| gi|229583216|ref|YP_002841615.1| WP_012710361.1.100559 WP_012710361.1.13477 WP_012710361.1.27011 WP_012710361.1.27461 WP_012710361.1.34992 WP_012710361.1.44962 WP_012710361.1.47130 WP_012710361.1.48461 WP_012710361.1.52267 WP_012710361.1.60638 WP_012710361.1.66823 WP_012710361.1.67233 WP_012710361.1.68242 WP_012710361.1.74483 WP_012710361.1.83431 WP_012710361.1.84481 WP_012710361.1.89621 WP_012710361.1.90709 WP_012710361.1.91160 WP_012710361.1.97021 gi|227829235|ref|YP_002831014.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]