SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012712172.1.44962 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012712172.1.44962
Domain Number 1 Region: 18-80
Classification Level Classification E-value
Superfamily Single hybrid motif 7.33e-16
Family Biotinyl/lipoyl-carrier proteins and domains 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012712172.1.44962
Sequence length 81
Comment biotin attachment protein [Sulfolobus islandicus]; AA=GCF_000245235.1; RF=na; TAX=1132504; STAX=43080; NAME=Sulfolobus islandicus M.16.43; strain=M.16.43; AL=Chromosome; RT=Major
Sequence
MQAELKIPEDIWPRRRDWGGEIVSLYIKEGSEIKIGDVIAEVEIEKAILKILSQYNGKVI
KVLVKEGDKILPGSVIALIEV
Download sequence
Identical sequences C3MKI3 C3MS04 C3N0Z3 C3N9L4 C3NLW1 C4KKF3 M9UH21
gi|227831219|ref|YP_002832999.1| gi|229585694|ref|YP_002844196.1| gi|229580108|ref|YP_002838508.1| gi|229581232|ref|YP_002839631.1| WP_012712172.1.100559 WP_012712172.1.13477 WP_012712172.1.27461 WP_012712172.1.44962 WP_012712172.1.47130 WP_012712172.1.48461 WP_012712172.1.52267 WP_012712172.1.60638 WP_012712172.1.66823 WP_012712172.1.67233 WP_012712172.1.68242 WP_012712172.1.74483 WP_012712172.1.83431 WP_012712172.1.84481 WP_012712172.1.89621 WP_012712172.1.90709 WP_012712172.1.91160 WP_012712172.1.97021 gi|479326455|ref|YP_007866510.1| gi|227828465|ref|YP_002830245.1| 419942.YN1551_0567 426118.M164_2214 427317.M1425_2213 427318.M1627_2292 429572.LS215_2378 439386.YG5714_2340 gi|238620657|ref|YP_002915483.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]