SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012712406.1.66823 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_012712406.1.66823
Domain Number - Region: 20-110
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 0.0259
Family Tetrahydrofolate dehydrogenase/cyclohydrolase 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012712406.1.66823
Sequence length 118
Comment hypothetical protein [Sulfolobus islandicus]; AA=GCF_000022385.1; RF=representative genome; TAX=429572; STAX=43080; NAME=Sulfolobus islandicus L.S.2.15; strain=L.S.2.15; AL=Complete Genome; RT=Major
Sequence
MEEGGVQTIDKLIEQLIESREAIESFLKLINALQKTGILPLLVGIVNSLDHNLAFLAEQN
AMLIRNVNVIYGVLSGKEEAKDISLTELIKQLNDPDVKRGLYLLLKILKAIGSASKEV
Download sequence
Identical sequences C3MLV7 C3MSQ6 C3NB40 C3NKI4 D2PH26
419942.YN1551_0285 427317.M1425_2475 429572.LS215_2642 439386.YG5714_2626 gi|227828717|ref|YP_002830497.1| gi|229580378|ref|YP_002838778.1| WP_012712406.1.13477 WP_012712406.1.34992 WP_012712406.1.52267 WP_012712406.1.66823 WP_012712406.1.68242 WP_012712406.1.89621 gi|284998993|ref|YP_003420761.1| gi|229580987|ref|YP_002839386.1| 2013590027 gi|227831456|ref|YP_002833236.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]