SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012717737.1.52267 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012717737.1.52267
Domain Number 1 Region: 6-78
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000251
Family Cgl2762-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012717737.1.52267
Sequence length 104
Comment helix-turn-helix domain-containing protein [Sulfolobus islandicus]; AA=GCF_000022485.1; RF=na; TAX=419942; STAX=43080; NAME=Sulfolobus islandicus Y.N.15.51; strain=Y.N.15.51; AL=Complete Genome; RT=Major
Sequence
MEDLVQAYEEEKDARIKERILAVKLHLVDGKSEKEVSKMLNKGYSTIKLWVGKYKKEGLD
GLRDKPRSGRPRKAEKEKQMGVFLCSHLIRELNAKLLEWRKNYF
Download sequence
Identical sequences C3NJ20
WP_012717737.1.52267 419942.YN1551_2108 gi|229582653|ref|YP_002841052.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]