SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012719828.1.3533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012719828.1.3533
Domain Number 1 Region: 2-130
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.35e-34
Family Transcriptional regulator Rrf2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012719828.1.3533
Sequence length 142
Comment MULTISPECIES: Rrf2 family transcriptional regulator [spotted fever group]; AA=GCF_000965145.1; RF=na; TAX=1359189; STAX=35792; NAME=Rickettsia parkeri str. Tate's Hell; strain=Tate's Hell; AL=Contig; RT=Major
Sequence
MQLTSFTDYGLRSLIYLASKPERICSVKEISEYHNISLNHLIKVIHRLAQLGYINSSKGK
GGGIKLAFSPSSMKLGDIIEKLEPNMDIVECFNKNTNSCKITNSCQFKHFIKEASEAFIK
TLNNYTLEDAMITKTIQIKDKL
Download sequence
Identical sequences A0A0F3QQF9 C3PNX5
gi|229586877|ref|YP_002845378.1| 347255.RAF_ORF0748 WP_012719828.1.22823 WP_012719828.1.24793 WP_012719828.1.29537 WP_012719828.1.3533 WP_012719828.1.42246 WP_012719828.1.49683 gi|383484156|ref|YP_005393069.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]