SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012727722.1.32866 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012727722.1.32866
Domain Number 1 Region: 1-199
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.39e-52
Family PP-loop ATPase 0.00015
Further Details:      
 
Domain Number 2 Region: 320-394
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000000392
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012727722.1.32866
Sequence length 408
Comment MULTISPECIES: tRNA(Ile)-lysidine synthetase [Exiguobacterium]; AA=GCF_000023045.1; RF=na; TAX=360911; STAX=360911; NAME=Exiguobacterium sp. AT1b; strain=AT1b; AL=Complete Genome; RT=Major
Sequence
MKKVLVAVSGGVDSIVLLDRLVKQGWDVGVAHVHHGLREASDEEYTFVAHVAASYQVAFH
GTRLHFQEGASQAHYRKARYHFFEDVMNEHGYDTLATAHHADDVLETVLIQLHRNVIEVK
GIPERRVFGRGTLIRPLLKETKAQLIEYARKNELAWREDATNQEVTYLRNRIRHEIIPRL
KQVWPTVVDDVYDTAKQVYAEWDRRYQSCEQWIEANVELGMKAFHVKLDEFNRLSSLERY
TVARLLSRRYGVEVNEALEKLRTSQKDTGTYHLSGEWFMMKQNRVLNLVQRSAEASLHPI
QVESLPAVVQFGKRTVSLSIEEGREGIPLNEITCPLTIRSLAPGDRMKLNVGTKKVSRIL
IDEKVERTIRPTLPLLEDASGRILAIVGVRVSDFLDKSDAICLRLMVK
Download sequence
Identical sequences C4KZU1
WP_012727722.1.32866 WP_012727722.1.48863 gi|229917403|ref|YP_002886049.1| 360911.EAT1b_1678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]