SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012730607.1.59255 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012730607.1.59255
Domain Number 1 Region: 747-994
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 2.88e-31
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.016
Further Details:      
 
Domain Number 2 Region: 33-217
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.77e-18
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.064
Further Details:      
 
Domain Number 3 Region: 461-648
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.25e-17
Family Pyruvate oxidase and decarboxylase PP module 0.047
Further Details:      
 
Weak hits

Sequence:  WP_012730607.1.59255
Domain Number - Region: 280-420
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 0.000303
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.053
Further Details:      
 
Domain Number - Region: 647-705
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.00479
Family Ferredoxin domains from multidomain proteins 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012730607.1.59255
Sequence length 1193
Comment indolepyruvate ferredoxin oxidoreductase [Burkholderia pseudomallei]; AA=GCF_001979485.1; RF=na; TAX=28450; STAX=28450; NAME=Burkholderia pseudomallei; strain=MSHR0391; AL=Contig; RT=Major
Sequence
MNAPLDAGQRASLEAALQSVTLDDKYTLERGRAYMSGIQALVRLPMLQQERDRAAGLNTA
GFISGYRGSPLGGLDLSLWKAKRHLAAHRIVFQPGINEDLAATAVWGSQQVNLYPGAKYD
GVFSMWYGKGPGVDRTGDVFKHANSAGSAPHGGVLVLAGDDHAAKSSTLAHQSEHIFKAC
GLPVLFPSNVQEYLDFGLHGWAMSRYSGLWVALKCVTDVVESSASVDIDPHRTQIVLPTD
FVMPDGGLNIRWPDPPLVQEARLLDYKWYAALAYVRANKLDRIEIDSPHARFGIVTGGKA
YLDVRQALVDLGLDDDTCARIGIRLYKVGCVWPLEAQGAQAFARGLDEILVVEEKRQILE
YAIKEELYNWPDGQRPRVFGKFDEKDGAGGEWSVPMGNWLLPAHYELSPAIIAKAIATRL
EKFELPSDVRARIAARIAVIEAKETALAKPHVSAERKPWFCSGCPHNTSTTVPEGSRAIA
GIGCHYMTVWMDRNTSTFSQMGGEGVPWIGQAPFTDEKHVFANLGDGTYFHSGLLAIRAA
IASKANITYKILYNDAVAMTGGQPVDGVLTVPQITHQLAAEGAKRIVIVTDEPRKYDGHT
SQLAPGVTIHHRDQLDDVQRTLREIEGTTILIYDQTCATEKRRRRKRGAYPDPAKRVVIN
EAVCEGCGDCSVQSNCLSVEPRETEFGTKRQINQSTCNKDFSCVKGFCPSFVTVEGGRLR
KPKAVSADASALPPMPEPVLPAIDRAYGVLVTGVGGTGVVTIGALLGMAAHLEGKGVTVL
DVTGLAQKGGAVMSHVQIAHAPADIHATRIAMGEADLVIGCDAIVTAGDECTSRMRHGTT
RVVVNSAQTPTAEFIKNPKWTFPGASAELDIRAAAGNAVDLVDANHFAVALLGDAIYTNP
FVLGYAWQRGWLPLAYASLVRAIELNGVQIEQNRAAFEWGRRAAFDPASVRAAAADDAQA
GATVIALHTKKAVDALIATRVEHLNAYQNAAYAARFSAVVSQARAAERALGADTAQEPLT
EAVARNLCKLMAYKDEYEVARLHAAPAFVAKLAEQFEGDWKLRFHLAPPLFAKKDARGRP
VKQQYGPWLMPVFRVLAKLKFLRGTAFDVFGRTEERRTERALIGEYEALVQELTGSRLTR
DTLPLAVELASLPDGIRGYGHVKENNLRAVRAKWAQLLAQWRSPEGGQTRNVA
Download sequence
Identical sequences C4KXE0
WP_012730607.1.101783 WP_012730607.1.1266 WP_012730607.1.22299 WP_012730607.1.24134 WP_012730607.1.26633 WP_012730607.1.31343 WP_012730607.1.3947 WP_012730607.1.56591 WP_012730607.1.59255 WP_012730607.1.61854 WP_012730607.1.63379 WP_012730607.1.69081 WP_012730607.1.69094 WP_012730607.1.75519 gi|237814179|ref|YP_002898630.1| 536230.GBP346_A3973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]