SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012731907.1.74818 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012731907.1.74818
Domain Number 1 Region: 2-320
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 7.46e-77
Family ATP synthase (F1-ATPase), gamma subunit 0.0000278
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012731907.1.74818
Sequence length 327
Comment F0F1 ATP synthase subunit gamma [Corynebacterium kroppenstedtii]; AA=GCF_000023145.1; RF=representative genome; TAX=645127; STAX=161879; NAME=Corynebacterium kroppenstedtii DSM 44385; strain=DSM 44385; AL=Complete Genome; RT=Major
Sequence
MATLRELRDRIKSVNSTKKITKAQELIATSKITKAQARVAASQPYAEEITKVVHRLSSAS
SLDHPMLREREGGNRAAILVVSSDRGMCGGYNHNVFKKVAELRALLEKQGYEVVLYVFGN
KGLTYYRFRGEALEGAWTGYSQDPEYEGTHQMRRHLIDAFVASSSGKAEWRPGLTAPEGE
SVQGFDQLHVVYTKFESMLSQKAVARQMLPMEAVIDYEEVETGEDMLSDPDDSEISANYE
FEPDATTLLSELLPHYVSRALYALLLESAASESAARRTAMSSATDNATELATTLSRTANQ
ARQAQITQEITEIVGGAGALDDSGESD
Download sequence
Identical sequences C4LJL5
gi|237785858|ref|YP_002906563.1| 645127.ckrop_1275 WP_012731907.1.74818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]