SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012734189.1.3777 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012734189.1.3777
Domain Number 1 Region: 615-1097
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-127
Family ALDH-like 0.000000209
Further Details:      
 
Domain Number 2 Region: 257-606
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 7.85e-121
Family Proline dehydrohenase domain of bifunctional PutA protein 0.0000000000607
Further Details:      
 
Domain Number 3 Region: 87-256
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 2.35e-64
Family N-terminal domain of bifunctional PutA protein 0.000000382
Further Details:      
 
Domain Number 4 Region: 4-45
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000252
Family PutA pre-N-terminal region-like 0.001
Further Details:      
 
Weak hits

Sequence:  WP_012734189.1.3777
Domain Number - Region: 1141-1262
Classification Level Classification E-value
Superfamily ALDH-like 0.00463
Family ALDH-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012734189.1.3777
Sequence length 1307
Comment trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Burkholderia glumae]; AA=GCF_000801065.1; RF=na; TAX=337; STAX=337; NAME=Burkholderia glumae; strain=NCPPB 3923; AL=Contig; RT=Major
Sequence
MASTTLGVKVDDLLRARLKDAAARLERTPHWLIKQAIFAYLERIEHGQLPAELSGRSGVA
ELADGQSDAEDGAPHPFLEFAQSVQPQSVLRAAITAAYRRPEPECVPFLIGQARLPAHLA
DAVQTMAAKLVETLRTKSSGGGVEGLIHEFSLSSQEGVALMCLAEALLRIPDRATRDALI
RDKISKGDWRSHVGHAPSLFVNAATWGLMITGKLVTTNSEAGLSSALTRMIGKGGEPLIR
KGVDMAMRLMGEQFVTGETISEALANSRKYEARGFRYSYDMLGEAATTEEDALRYYASYE
QAIHAIGKAAGSRGIYEGPGISIKLSALHARYSRAQQERTMTELLPRVRALALLARRYDI
GLNIDAEEADRLEISLDLLEALCFDPELTGWNGIGFVVQAYQKRCPFVIDYLIDLARRSR
HRLMIRLVKGAYWDSEIKRAQVDGLEGYPVYTRKIYTDVSYLACAKKLLGAPDAVYPQFA
THNAHTLSAIYHLAGQNYYPGQYEFQCLHGMGEPLYEEVTGRDKLNRPCRVYAPVGTHET
LLAYLVRRLLENGANTSFVNRIADKTVAVKELVADPVEEAARIVPLGAPHAKIPLPRQLY
GDSRANSMGLDLSNEHRLASLSSALLTSAHHPWRAAPLLADEALDDAPAREVRNPADQRD
VVGTVSEATPEHVSAALAHAVSAAPIWQATPVEARADCLARAADLLEAQMHTLMGLVVRE
AGKSLPNAVAEIREAIDFLRYYSAQIRDEFSNDTHRPLGPVVCISPWNFPLAIFMGQVAA
ALAAGNTVLAKPAEQTPLIAAQAVRLLREAGVPAGAVQLLPGDGETVGAALVSDPRTRAV
MFTGSTEVARLINKVLAGRLDPDGKPIPLIAETGGQNAMIVDSSALAEQVVADVLNSAFD
SAGQRCSALRVLCLQDDVAERTLTMLKGAMHELSLGNPDRLSTDVGPVIDADAKRTIDAH
VAAMKDKGHAVTQLPMPEGCAHGTFVPPTLIEIDSIDELKREVFGPVLHVLRYRRSGLDK
LLDQVRATGYGLTLGIHTRIDETIAHVIGRAHVGNIYVNRNVVGAVVGVQPFGGEGLSGT
GPKAGGALYLQRLLATRPAGLPKSLEAALVVDAPGDRESGDNPSSALAALRDWLIEQREP
ALAARCEGYLARVLAGATAVLPGPTGERNTYTLGPRGTVLCVAATAKGARAQLAAVLATG
NRALFAGAAGEALAAALPAALKPYAGVRKQPDAGFDAVLFEGDSDELLALVKEVSQRPGP
IVSVQGVAAGAFENGDEDYALERLLTERSVSVNTAAAGGNANLMTIG
Download sequence
Identical sequences A0A2H9XM18 A0A2J9H6A1 C5A879
WP_012734189.1.3777 WP_012734189.1.43144 WP_012734189.1.53941 WP_012734189.1.99142 gi|238025761|ref|YP_002909992.1| 626418.bglu_1g00850

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]