SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012734301.1.53941 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012734301.1.53941
Domain Number 1 Region: 5-275
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.69e-96
Family Methylenetetrahydrofolate reductase 0.000000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012734301.1.53941
Sequence length 276
Comment methylenetetrahydrofolate reductase [NAD(P)H] [Burkholderia glumae]; AA=GCF_002206305.1; RF=na; TAX=337; STAX=337; NAME=Burkholderia glumae; strain=FDAARGOS_346; AL=Contig; RT=Major
Sequence
MKPIELSLEFFPPKTAEGVDKLRATRAQLLPLKPKFVSVTFGAGGSTQQGTLDTVLDMQK
DGLLAAPHLSCIGASKDNLRAVLDQYRSHGIRHIVALRGDLPSGMGEVGELRYASELVSF
IRAEHGDWFRLEVAAYPEYHPQSRSPKLDLLHFAEKVKAGANSAITQYFFNADAYFRFVD
DARKLGVDVPIVPGIMPITNFTQLMRFSEMCGAEVPRWVARRLESFGDDKESIRAFGADV
VTAMCERLIREGAPGLHFYTLNAATATKVVCERLGF
Download sequence
Identical sequences A0A2H9XL26 A0A2J9HED4 C5A8X3
gi|238025875|ref|YP_002910106.1| WP_012734301.1.31674 WP_012734301.1.43144 WP_012734301.1.53941 WP_012734301.1.99142 626418.bglu_1g02010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]