SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012739735.1.74791 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012739735.1.74791
Domain Number 1 Region: 4-149
Classification Level Classification E-value
Superfamily Nudix 1.62e-31
Family MutT-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012739735.1.74791
Sequence length 152
Comment DNA mismatch repair protein MutT [[Eubacterium] eligens]; AA=GCF_000146185.1; RF=representative genome; TAX=515620; STAX=39485; NAME=[Eubacterium] eligens ATCC 27750; strain=ATCC 27750; AL=Complete Genome; RT=Major
Sequence
MPNYIMDLRKLVGHRTLMQCAASIIIVNENNQILLGKRTDNHKWGYAGGSIELDEKVEDC
ARRELYEETGLVADEIEFFMVNSGPEVHYIYPNGDEVSNIEIIYVCRRYHGELKRQEEEI
EELRFFNLEDIDIDNISPPIRPVVKRFIEQYS
Download sequence
Identical sequences C4Z2C5
WP_012739735.1.74791 515620.EUBELI_01508 gi|238917430|ref|YP_002930947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]