SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_012740306.1.40640 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012740306.1.40640
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Superoxide reductase-like 1.83e-24
Family Superoxide reductase-like 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_012740306.1.40640
Sequence length 77
Comment superoxide dismutase, partial [[Eubacterium] eligens]; AA=GCF_001405395.1; RF=na; TAX=39485; STAX=39485; NAME=[Eubacterium] eligens; strain=2789STDY5834878; AL=Contig; RT=Major
Sequence
MEVYTVEGSHVHVVVGETKHPMLEEHFIEWITLNTNQGIYRKQLNPGQEPVADFCLCDGE
QVEEVYAYCNLHGLWKC
Download sequence
Identical sequences A0A174Z208 C4Z794
gi|238921792|ref|YP_002935306.1| WP_012740306.1.40640 WP_012740306.1.74791 WP_012740306.1.89035 515620.EUBELI_20025 gi|238921792|ref|YP_002935306.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]