SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012740716.1.74791 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012740716.1.74791
Domain Number 1 Region: 24-82
Classification Level Classification E-value
Superfamily YefM-like 0.00000000719
Family YefM-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012740716.1.74791
Sequence length 112
Comment antitoxin PHD [[Eubacterium] eligens]; AA=GCF_000146185.1; RF=representative genome; TAX=515620; STAX=39485; NAME=[Eubacterium] eligens ATCC 27750; strain=ATCC 27750; AL=Complete Genome; RT=Major
Sequence
MEVVNVAIATNILQCLIPISQFNKGQASKIFDRLHDEKELIVLKNNQPSAVILSPEEYTR
LTEIEEDYYLLIEATKRIEDNGNKETVSMDYVMRNLGIDEKELENAEDIDIE
Download sequence
Identical sequences C4Z6J6
WP_012740716.1.74791 WP_012740716.1.89035 gi|238922208|ref|YP_002935722.1| 515620.EUBELI_20443 gi|238922208|ref|YP_002935722.1|NC_012780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]