SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012740861.1.74791 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012740861.1.74791
Domain Number 1 Region: 289-601
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.73e-100
Family SCOPe 0.00085
Further Details:      
 
Domain Number 2 Region: 9-144,172-186
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.25e-50
Family SCOPe 0.0015
Further Details:      
 
Domain Number 3 Region: 192-285
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 7.57e-24
Family SCOPe 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_012740861.1.74791
Sequence length 611
Comment beta-glucuronidase [[Eubacterium] eligens]; AA=GCF_000146185.1; RF=representative genome; TAX=515620; STAX=39485; NAME=[Eubacterium] eligens ATCC 27750; strain=ATCC 27750; AL=Complete Genome; RT=Major
Sequence
MLYPVLTQSRLLSDLSGVWDFKLDNGKGFEEKWYEKPLKDADTMPVPASYNDLKEGTDFR
DHYGWVFYQRNISVPEYVKSQRIVLRCAAVTHYAMIYLNGKLICEHKGGFLPFEVELNDD
LQDGDNLLTIAVNNVIDYTTLPVGGKANMMSGMMGGMGAGASDKPQNNPNFDFFNYCGIT
RPVKIYTTPETYINDITVTADIDFTKEEPSAVLNYNVEIKGKDYNNITCKVELFDEEGTK
LSETEGSEGTFEISNVRLWQPLNAYLYKIKVTAGQDVYTLPYGVRSVRVDGTKFLINEKP
FYFKGYGKHEDTFPNGRGINLPMNTKDISIMKWQHANSFRTSHYPYSEEMMRLCDEEGIV
VIDETTAVGVNLQFGGGANFGGERIGTFDKEHGVQTQEHHKDVIRDLISRDKNHACVVMW
SIANEPDSAAEGAYDYFKPLYDLARELDPQKRPCTLVSVQGTTADTDCSSQLSDVICLNR
YYGWYFGGPDLEVSEIGLRKELSDWGKLGKPVMFTEYGADTVSGLHDTTSVMYTEEYQVE
YYEMNNKVFDEFDFVVGEQAWNFADFATSQSLLRVQGNKKGLFTRDRKPKMVAHYFRNRW
STIPEFGYKTK
Download sequence
Identical sequences C4Z6Z2
6bo6_A WP_012740861.1.74791 gi|238922354|ref|YP_002935868.1|NC_012780 gi|238922354|ref|YP_002935868.1| 515620.EUBELI_20590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]