SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_012751725.1.71054 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_012751725.1.71054
Domain Number 1 Region: 163-256
Classification Level Classification E-value
Superfamily PTS system IIB component-like 7.15e-29
Family PTS system, Fructose specific IIB subunit-like 0.00024
Further Details:      
 
Domain Number 2 Region: 2-145
Classification Level Classification E-value
Superfamily Phoshotransferase/anion transport protein 6.93e-28
Family IIA domain of mannitol-specific and ntr phosphotransferase EII 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_012751725.1.71054
Sequence length 660
Comment PTS fructose transporter subunit IIABC [Mycoplasma conjunctivae]; AA=GCF_000026765.1; RF=representative genome; TAX=45361; STAX=45361; NAME=Mycoplasma conjunctivae; strain=HRC/581T; AL=Chromosome; RT=Major
Sequence
MNIFTRDNIFLNQKLHSKEEVFDFIINVAFDLKITDNKEKLLADLQAREAQISTGLEQEF
AIPHAQSEAVKSPTLFYISLESGIAWENQDQSKAKYLFVILLPKKYTDDTQVELLAQIAT
MILDEKQIVELKSNNLERIYQAISNQSTKQKSIKINEEQPLALAITSCPVGIAHTYLAAE
KISEAFSKAGFASQVETRGSVGPKNVITQEQIDKAQFVIIAADVQIETEQFIGKKVLFCS
TKDAIHQADKMVEKAQSAPILKGERNISTQKSDKPGLLKHVITGISYMIPYVVFGGIMIA
LSLGIGKSIYGSGNEAPKGDFLWYMLQIGVVSFNIMIGALGAYIAYSIAGRAALMPAFVT
STVANNAGLFYNIGGINVQTPMGFLGAILFGYLIGYTVKYIANLKIQNSISAVIPIFVIP
IGVTLFYSLIVVFVIGAPIGYVMDKFIKTLESVFSNKDGLNLGIVILLGFLLGGMIGFDM
GGPINKVAFLTSATLVASKIFEPMGMVAAAIPVAPIGMGLTTLVFGKKFDRQEKSLGISA
IIMGFIGISEGAIPFAVSDPKRVVFANVIGSAVAGAIAAALSVTNAAAHGGPIVGVLGAI
SSNNYGVGGGIAFFFVAILIGSVVTMLIYGLTRNRDFKFFSSNKINFLSAKKAPRKDKNA
Download sequence
Identical sequences C5J6W9
WP_012751725.1.71054 45361.MCJ_005330 gi|240047647|ref|YP_002961035.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]